Placeholder image of a protein
Icon representing a puzzle

1387: Unsolved De-novo Freestyle 106

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
June 06, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SEFQKEMKKLEETLKKGDEETFRELLKELEKRVREHGREDYKEILKRLREYLEKGDKESLQRLFEETKKS

Top groups

  1. Avatar for Russian team 11. Russian team 2 pts. 9,197
  2. Avatar for Natural Abilities 12. Natural Abilities 1 pt. 9,147
  3. Avatar for xkcd 13. xkcd 1 pt. 9,101
  4. Avatar for freefolder 14. freefolder 1 pt. 8,968
  5. Avatar for Richard Dawkins Foundation 15. Richard Dawkins Foundation 1 pt. 8,254
  6. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 7,386
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 7,037
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 0
  1. Avatar for bitwave 131. bitwave Lv 1 1 pt. 7,514
  2. Avatar for cnhrcolemam 132. cnhrcolemam Lv 1 1 pt. 7,484
  3. Avatar for j.wohlmann 133. j.wohlmann Lv 1 1 pt. 7,461
  4. Avatar for mdhalloran 134. mdhalloran Lv 1 1 pt. 7,414
  5. Avatar for uitham 135. uitham Lv 1 1 pt. 7,386
  6. Avatar for deathbat_87 136. deathbat_87 Lv 1 1 pt. 7,375
  7. Avatar for jybourque 137. jybourque Lv 1 1 pt. 7,154
  8. Avatar for doctaven 138. doctaven Lv 1 1 pt. 7,037
  9. Avatar for sarahlav7 139. sarahlav7 Lv 1 1 pt. 6,911
  10. Avatar for RealCold 140. RealCold Lv 1 1 pt. 6,854

Comments