Placeholder image of a protein
Icon representing a puzzle

1387: Unsolved De-novo Freestyle 106

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
June 06, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SEFQKEMKKLEETLKKGDEETFRELLKELEKRVREHGREDYKEILKRLREYLEKGDKESLQRLFEETKKS

Top groups

  1. Avatar for Russian team 11. Russian team 2 pts. 9,197
  2. Avatar for Natural Abilities 12. Natural Abilities 1 pt. 9,147
  3. Avatar for xkcd 13. xkcd 1 pt. 9,101
  4. Avatar for freefolder 14. freefolder 1 pt. 8,968
  5. Avatar for Richard Dawkins Foundation 15. Richard Dawkins Foundation 1 pt. 8,254
  6. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 7,386
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 7,037
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 0
  1. Avatar for smit1892 151. smit1892 Lv 1 1 pt. 5,248
  2. Avatar for vasya_lebedev 152. vasya_lebedev Lv 1 1 pt. 4,991
  3. Avatar for Jaime_Navarrete 153. Jaime_Navarrete Lv 1 1 pt. 0
  4. Avatar for aepatis94 154. aepatis94 Lv 1 1 pt. 0
  5. Avatar for aspadistra 155. aspadistra Lv 1 1 pt. 0
  6. Avatar for dsilverb 156. dsilverb Lv 1 1 pt. 0
  7. Avatar for jeff101 157. jeff101 Lv 1 1 pt. 0
  8. Avatar for Hollinas 158. Hollinas Lv 1 1 pt. 0
  9. Avatar for potatopotatopotato 159. potatopotatopotato Lv 1 1 pt. 0

Comments