Placeholder image of a protein
Icon representing a puzzle

1387: Unsolved De-novo Freestyle 106

Closed since almost 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary

Created
June 06, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SEFQKEMKKLEETLKKGDEETFRELLKELEKRVREHGREDYKEILKRLREYLEKGDKESLQRLFEETKKS

Top groups

  1. Avatar for Russian team 11. Russian team 2 pts. 9,197
  2. Avatar for Natural Abilities 12. Natural Abilities 1 pt. 9,147
  3. Avatar for xkcd 13. xkcd 1 pt. 9,101
  4. Avatar for freefolder 14. freefolder 1 pt. 8,968
  5. Avatar for Richard Dawkins Foundation 15. Richard Dawkins Foundation 1 pt. 8,254
  6. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 7,386
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 7,037
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 0
  1. Avatar for isaksson 21. isaksson Lv 1 51 pts. 9,476
  2. Avatar for Timo van der Laan 22. Timo van der Laan Lv 1 50 pts. 9,468
  3. Avatar for pauldunn 23. pauldunn Lv 1 48 pts. 9,467
  4. Avatar for Bruno Kestemont 24. Bruno Kestemont Lv 1 46 pts. 9,466
  5. Avatar for christioanchauvin 25. christioanchauvin Lv 1 44 pts. 9,464
  6. Avatar for dcrwheeler 26. dcrwheeler Lv 1 43 pts. 9,462
  7. Avatar for kabubi 27. kabubi Lv 1 41 pts. 9,446
  8. Avatar for johnmitch 28. johnmitch Lv 1 40 pts. 9,433
  9. Avatar for toshiue 29. toshiue Lv 1 38 pts. 9,432
  10. Avatar for Skippysk8s 30. Skippysk8s Lv 1 37 pts. 9,432

Comments