Placeholder image of a protein
Icon representing a puzzle

1387: Unsolved De-novo Freestyle 106

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
June 06, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SEFQKEMKKLEETLKKGDEETFRELLKELEKRVREHGREDYKEILKRLREYLEKGDKESLQRLFEETKKS

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,758
  2. Avatar for Gargleblasters 2. Gargleblasters 74 pts. 9,732
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 9,731
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 38 pts. 9,721
  5. Avatar for Contenders 5. Contenders 27 pts. 9,678
  6. Avatar for Void Crushers 6. Void Crushers 18 pts. 9,468
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 12 pts. 9,464
  8. Avatar for Marvin's bunch 8. Marvin's bunch 8 pts. 9,365
  9. Avatar for HMT heritage 9. HMT heritage 5 pts. 9,338
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 3 pts. 9,223
  1. Avatar for isaksson 21. isaksson Lv 1 51 pts. 9,476
  2. Avatar for Timo van der Laan 22. Timo van der Laan Lv 1 50 pts. 9,468
  3. Avatar for pauldunn 23. pauldunn Lv 1 48 pts. 9,467
  4. Avatar for Bruno Kestemont 24. Bruno Kestemont Lv 1 46 pts. 9,466
  5. Avatar for christioanchauvin 25. christioanchauvin Lv 1 44 pts. 9,464
  6. Avatar for dcrwheeler 26. dcrwheeler Lv 1 43 pts. 9,462
  7. Avatar for kabubi 27. kabubi Lv 1 41 pts. 9,446
  8. Avatar for johnmitch 28. johnmitch Lv 1 40 pts. 9,433
  9. Avatar for toshiue 29. toshiue Lv 1 38 pts. 9,432
  10. Avatar for Skippysk8s 30. Skippysk8s Lv 1 37 pts. 9,432

Comments