Placeholder image of a protein
Icon representing a puzzle

1387: Unsolved De-novo Freestyle 106

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
June 06, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SEFQKEMKKLEETLKKGDEETFRELLKELEKRVREHGREDYKEILKRLREYLEKGDKESLQRLFEETKKS

Top groups

  1. Avatar for Russian team 11. Russian team 2 pts. 9,197
  2. Avatar for Natural Abilities 12. Natural Abilities 1 pt. 9,147
  3. Avatar for xkcd 13. xkcd 1 pt. 9,101
  4. Avatar for freefolder 14. freefolder 1 pt. 8,968
  5. Avatar for Richard Dawkins Foundation 15. Richard Dawkins Foundation 1 pt. 8,254
  6. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 7,386
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 7,037
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 0
  1. Avatar for mimi 31. mimi Lv 1 35 pts. 9,429
  2. Avatar for TastyMunchies 32. TastyMunchies Lv 1 34 pts. 9,419
  3. Avatar for dizzywings 33. dizzywings Lv 1 33 pts. 9,419
  4. Avatar for smilingone 34. smilingone Lv 1 31 pts. 9,413
  5. Avatar for diamonddays 35. diamonddays Lv 1 30 pts. 9,412
  6. Avatar for Deleted player 36. Deleted player pts. 9,390
  7. Avatar for WBarme1234 37. WBarme1234 Lv 1 28 pts. 9,383
  8. Avatar for Vinara 38. Vinara Lv 1 27 pts. 9,367
  9. Avatar for frood66 39. frood66 Lv 1 26 pts. 9,365
  10. Avatar for nicobul 40. nicobul Lv 1 25 pts. 9,362

Comments