Placeholder image of a protein
Icon representing a puzzle

1387: Unsolved De-novo Freestyle 106

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
June 06, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SEFQKEMKKLEETLKKGDEETFRELLKELEKRVREHGREDYKEILKRLREYLEKGDKESLQRLFEETKKS

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,758
  2. Avatar for Gargleblasters 2. Gargleblasters 74 pts. 9,732
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 9,731
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 38 pts. 9,721
  5. Avatar for Contenders 5. Contenders 27 pts. 9,678
  6. Avatar for Void Crushers 6. Void Crushers 18 pts. 9,468
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 12 pts. 9,464
  8. Avatar for Marvin's bunch 8. Marvin's bunch 8 pts. 9,365
  9. Avatar for HMT heritage 9. HMT heritage 5 pts. 9,338
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 3 pts. 9,223
  1. Avatar for mimi 31. mimi Lv 1 35 pts. 9,429
  2. Avatar for TastyMunchies 32. TastyMunchies Lv 1 34 pts. 9,419
  3. Avatar for dizzywings 33. dizzywings Lv 1 33 pts. 9,419
  4. Avatar for smilingone 34. smilingone Lv 1 31 pts. 9,413
  5. Avatar for diamonddays 35. diamonddays Lv 1 30 pts. 9,412
  6. Avatar for Deleted player 36. Deleted player pts. 9,390
  7. Avatar for WBarme1234 37. WBarme1234 Lv 1 28 pts. 9,383
  8. Avatar for Vinara 38. Vinara Lv 1 27 pts. 9,367
  9. Avatar for frood66 39. frood66 Lv 1 26 pts. 9,365
  10. Avatar for nicobul 40. nicobul Lv 1 25 pts. 9,362

Comments