Placeholder image of a protein
Icon representing a puzzle

1387: Unsolved De-novo Freestyle 106

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
June 06, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SEFQKEMKKLEETLKKGDEETFRELLKELEKRVREHGREDYKEILKRLREYLEKGDKESLQRLFEETKKS

Top groups

  1. Avatar for Russian team 11. Russian team 2 pts. 9,197
  2. Avatar for Natural Abilities 12. Natural Abilities 1 pt. 9,147
  3. Avatar for xkcd 13. xkcd 1 pt. 9,101
  4. Avatar for freefolder 14. freefolder 1 pt. 8,968
  5. Avatar for Richard Dawkins Foundation 15. Richard Dawkins Foundation 1 pt. 8,254
  6. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 7,386
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 7,037
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 0
  1. Avatar for SaraL 71. SaraL Lv 1 6 pts. 9,196
  2. Avatar for MadCat08 72. MadCat08 Lv 1 6 pts. 9,190
  3. Avatar for froggs554 73. froggs554 Lv 1 5 pts. 9,188
  4. Avatar for Bautho 74. Bautho Lv 1 5 pts. 9,166
  5. Avatar for hansvandenhof 75. hansvandenhof Lv 1 5 pts. 9,164
  6. Avatar for Bobnine 76. Bobnine Lv 1 5 pts. 9,161
  7. Avatar for georg137 77. georg137 Lv 1 4 pts. 9,158
  8. Avatar for YGK 78. YGK Lv 1 4 pts. 9,152
  9. Avatar for cinnamonkitty 79. cinnamonkitty Lv 1 4 pts. 9,148
  10. Avatar for Mr_Jolty 80. Mr_Jolty Lv 1 4 pts. 9,147

Comments