Placeholder image of a protein
Icon representing a puzzle

1387: Unsolved De-novo Freestyle 106

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
June 06, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SEFQKEMKKLEETLKKGDEETFRELLKELEKRVREHGREDYKEILKRLREYLEKGDKESLQRLFEETKKS

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,758
  2. Avatar for Gargleblasters 2. Gargleblasters 74 pts. 9,732
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 9,731
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 38 pts. 9,721
  5. Avatar for Contenders 5. Contenders 27 pts. 9,678
  6. Avatar for Void Crushers 6. Void Crushers 18 pts. 9,468
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 12 pts. 9,464
  8. Avatar for Marvin's bunch 8. Marvin's bunch 8 pts. 9,365
  9. Avatar for HMT heritage 9. HMT heritage 5 pts. 9,338
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 3 pts. 9,223
  1. Avatar for SaraL 71. SaraL Lv 1 6 pts. 9,196
  2. Avatar for MadCat08 72. MadCat08 Lv 1 6 pts. 9,190
  3. Avatar for froggs554 73. froggs554 Lv 1 5 pts. 9,188
  4. Avatar for Bautho 74. Bautho Lv 1 5 pts. 9,166
  5. Avatar for hansvandenhof 75. hansvandenhof Lv 1 5 pts. 9,164
  6. Avatar for Bobnine 76. Bobnine Lv 1 5 pts. 9,161
  7. Avatar for georg137 77. georg137 Lv 1 4 pts. 9,158
  8. Avatar for YGK 78. YGK Lv 1 4 pts. 9,152
  9. Avatar for cinnamonkitty 79. cinnamonkitty Lv 1 4 pts. 9,148
  10. Avatar for Mr_Jolty 80. Mr_Jolty Lv 1 4 pts. 9,147

Comments