Placeholder image of a protein
Icon representing a puzzle

1388: Revisiting Puzzle 114: Black Mamba

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
June 07, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,297
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 10,248
  3. Avatar for Contenders 3. Contenders 58 pts. 10,221
  4. Avatar for Gargleblasters 4. Gargleblasters 43 pts. 10,204
  5. Avatar for Go Science 5. Go Science 31 pts. 10,186
  6. Avatar for Void Crushers 6. Void Crushers 22 pts. 10,152
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 10,151
  8. Avatar for Marvin's bunch 8. Marvin's bunch 11 pts. 10,090
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 10,050
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 5 pts. 9,924
  1. Avatar for SilvaTempus 141. SilvaTempus Lv 1 1 pt. 8,495
  2. Avatar for smit1892 142. smit1892 Lv 1 1 pt. 8,495
  3. Avatar for mike59 143. mike59 Lv 1 1 pt. 8,486
  4. Avatar for FritzsHero 144. FritzsHero Lv 1 1 pt. 8,484
  5. Avatar for Simek 145. Simek Lv 1 1 pt. 8,465
  6. Avatar for momadoc 146. momadoc Lv 1 1 pt. 8,425
  7. Avatar for awes0meb0y 147. awes0meb0y Lv 1 1 pt. 8,423
  8. Avatar for Milena.soares 148. Milena.soares Lv 1 1 pt. 8,358
  9. Avatar for Cerebro 149. Cerebro Lv 1 1 pt. 8,349
  10. Avatar for Tac1 150. Tac1 Lv 1 1 pt. 8,347

Comments