Placeholder image of a protein
Icon representing a puzzle

1393: Unsolved De-novo Freestyle 107

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
June 20, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


EKDEKIMEEMKKLVEQVKKKGGRVRITIRKENGTVRIRVEVDVDGHDTTVEWEGGSDDVMEHVKQQLQEVKDQHN

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,445
  2. Avatar for Beta Folders 2. Beta Folders 74 pts. 9,430
  3. Avatar for Void Crushers 3. Void Crushers 54 pts. 9,393
  4. Avatar for Marvin's bunch 4. Marvin's bunch 38 pts. 9,390
  5. Avatar for Go Science 5. Go Science 27 pts. 9,372
  6. Avatar for Contenders 6. Contenders 18 pts. 9,369
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 9,347
  8. Avatar for HMT heritage 8. HMT heritage 8 pts. 9,300
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 5 pts. 9,292
  10. Avatar for xkcd 10. xkcd 3 pts. 9,225
  1. Avatar for darioarena 101. darioarena Lv 1 1 pt. 8,560
  2. Avatar for Ref_Jo 102. Ref_Jo Lv 1 1 pt. 8,559
  3. Avatar for goldfish80 103. goldfish80 Lv 1 1 pt. 8,533
  4. Avatar for Superphosphate 104. Superphosphate Lv 1 1 pt. 8,509
  5. Avatar for FractalCuber 105. FractalCuber Lv 1 1 pt. 8,481
  6. Avatar for jausmh 106. jausmh Lv 1 1 pt. 8,480
  7. Avatar for rsosborne 107. rsosborne Lv 1 1 pt. 8,453
  8. Avatar for Mydogisa Toelicker 108. Mydogisa Toelicker Lv 1 1 pt. 8,441
  9. Avatar for mcatneuro1 109. mcatneuro1 Lv 1 1 pt. 8,360
  10. Avatar for rabamino12358 110. rabamino12358 Lv 1 1 pt. 8,338

Comments