Placeholder image of a protein
Icon representing a puzzle

1396: Unsolved De-novo Freestyle 108

Closed since over 8 years ago

Intermediate Overall Prediction

Summary


Created
June 27, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


STDDEVEKLREEVQRKGGKVEVKKENGKHKVRVKFETENKTVELTVTNEEQVKRMQKQVEEQIKK

Top groups


  1. Avatar for Gargleblasters 100 pts. 9,283
  2. Avatar for Go Science 2. Go Science 78 pts. 9,249
  3. Avatar for Beta Folders 3. Beta Folders 60 pts. 9,220
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 45 pts. 9,218
  5. Avatar for Marvin's bunch 5. Marvin's bunch 33 pts. 9,194
  6. Avatar for Contenders 6. Contenders 24 pts. 9,178
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 17 pts. 9,162
  8. Avatar for Void Crushers 8. Void Crushers 12 pts. 9,155
  9. Avatar for HMT heritage 9. HMT heritage 8 pts. 9,128
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 6 pts. 9,091

  1. Avatar for ViJay7019 91. ViJay7019 Lv 1 2 pts. 8,730
  2. Avatar for justjustin 92. justjustin Lv 1 2 pts. 8,725
  3. Avatar for deLaCeiba 93. deLaCeiba Lv 1 2 pts. 8,694
  4. Avatar for mitarcher 94. mitarcher Lv 1 1 pt. 8,680
  5. Avatar for jamiexq 95. jamiexq Lv 1 1 pt. 8,672
  6. Avatar for DrCompchem 96. DrCompchem Lv 1 1 pt. 8,667
  7. Avatar for Jim Fraser 97. Jim Fraser Lv 1 1 pt. 8,657
  8. Avatar for senor pit 98. senor pit Lv 1 1 pt. 8,648
  9. Avatar for Flagg65a 99. Flagg65a Lv 1 1 pt. 8,628
  10. Avatar for carsonfb 100. carsonfb Lv 1 1 pt. 8,627

Comments