Placeholder image of a protein
Icon representing a puzzle

1397: Revisiting Puzzle 124: PDZ Domain

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
June 29, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,470
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 76 pts. 9,437
  3. Avatar for Contenders 3. Contenders 56 pts. 9,413
  4. Avatar for Gargleblasters 4. Gargleblasters 41 pts. 9,409
  5. Avatar for Void Crushers 5. Void Crushers 29 pts. 9,394
  6. Avatar for Go Science 6. Go Science 20 pts. 9,390
  7. Avatar for Marvin's bunch 7. Marvin's bunch 14 pts. 9,371
  8. Avatar for HMT heritage 8. HMT heritage 9 pts. 9,351
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 6 pts. 9,302
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 4 pts. 9,209
  1. Avatar for stomjoh 61. stomjoh Lv 1 8 pts. 9,139
  2. Avatar for manu8170 62. manu8170 Lv 1 8 pts. 9,138
  3. Avatar for deLaCeiba 63. deLaCeiba Lv 1 7 pts. 9,137
  4. Avatar for diamonddays 64. diamonddays Lv 1 7 pts. 9,121
  5. Avatar for toshiue 65. toshiue Lv 1 7 pts. 9,107
  6. Avatar for Vincera 66. Vincera Lv 1 6 pts. 9,106
  7. Avatar for tomespen 67. tomespen Lv 1 6 pts. 9,102
  8. Avatar for lupussapien 68. lupussapien Lv 1 6 pts. 9,099
  9. Avatar for Vinara 69. Vinara Lv 1 5 pts. 9,096
  10. Avatar for Anton Trikshev 70. Anton Trikshev Lv 1 5 pts. 9,087

Comments