Placeholder image of a protein
Icon representing a puzzle

1400: Revisiting Puzzle 125: Ice Binding Protein

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
July 06, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for HMT heritage
    1. HMT heritage
    100 pts. 9,027
  2. Avatar for Contenders 2. Contenders 74 pts. 9,022
  3. Avatar for Go Science 3. Go Science 54 pts. 9,014
  4. Avatar for Beta Folders 4. Beta Folders 38 pts. 9,014
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 27 pts. 9,001
  6. Avatar for Gargleblasters 6. Gargleblasters 18 pts. 8,992
  7. Avatar for Void Crushers 7. Void Crushers 12 pts. 8,966
  8. Avatar for FoldIt@Netherlands 8. FoldIt@Netherlands 8 pts. 8,962
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 5 pts. 8,929
  10. Avatar for Marvin's bunch 10. Marvin's bunch 3 pts. 8,894
  1. Avatar for 181818 111. 181818 Lv 1 1 pt. 8,408
  2. Avatar for Arne Heessels 112. Arne Heessels Lv 1 1 pt. 8,392
  3. Avatar for ThomasWester 113. ThomasWester Lv 1 1 pt. 8,389
  4. Avatar for jackie123 114. jackie123 Lv 1 1 pt. 8,378
  5. Avatar for metafolder 115. metafolder Lv 1 1 pt. 8,366
  6. Avatar for alwen 116. alwen Lv 1 1 pt. 8,358
  7. Avatar for parsnip 117. parsnip Lv 1 1 pt. 8,352
  8. Avatar for navn 118. navn Lv 1 1 pt. 8,337
  9. Avatar for rabamino12358 119. rabamino12358 Lv 1 1 pt. 8,321
  10. Avatar for casprus 120. casprus Lv 1 1 pt. 8,321

Comments