Placeholder image of a protein
Icon representing a puzzle

1400: Revisiting Puzzle 125: Ice Binding Protein

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
July 06, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for HMT heritage
    1. HMT heritage
    100 pts. 9,027
  2. Avatar for Contenders 2. Contenders 74 pts. 9,022
  3. Avatar for Go Science 3. Go Science 54 pts. 9,014
  4. Avatar for Beta Folders 4. Beta Folders 38 pts. 9,014
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 27 pts. 9,001
  6. Avatar for Gargleblasters 6. Gargleblasters 18 pts. 8,992
  7. Avatar for Void Crushers 7. Void Crushers 12 pts. 8,966
  8. Avatar for FoldIt@Netherlands 8. FoldIt@Netherlands 8 pts. 8,962
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 5 pts. 8,929
  10. Avatar for Marvin's bunch 10. Marvin's bunch 3 pts. 8,894
  1. Avatar for Anton Trikshev 101. Anton Trikshev Lv 1 1 pt. 8,547
  2. Avatar for SKSbell 102. SKSbell Lv 1 1 pt. 8,543
  3. Avatar for drjr 103. drjr Lv 1 1 pt. 8,540
  4. Avatar for SaraL 104. SaraL Lv 1 1 pt. 8,535
  5. Avatar for tony46 105. tony46 Lv 1 1 pt. 8,529
  6. Avatar for MadCat08 106. MadCat08 Lv 1 1 pt. 8,529
  7. Avatar for harvardman 107. harvardman Lv 1 1 pt. 8,500
  8. Avatar for rinze 108. rinze Lv 1 1 pt. 8,479
  9. Avatar for lamoille 109. lamoille Lv 1 1 pt. 8,462
  10. Avatar for leehaggis 110. leehaggis Lv 1 1 pt. 8,456

Comments