Placeholder image of a protein
Icon representing a puzzle

1402: Unsolved De-novo Freestyle 110

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
July 11, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


EEDELKEYKKQIEKEVSEEETIKIVETILEIIMKTSRSEQILKEIKKIIKKQNSTVHVNIHVGNVHINIHVNDDSVDVQVHVGNVKVTTG

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,819
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 9,727
  3. Avatar for Gargleblasters 3. Gargleblasters 49 pts. 9,680
  4. Avatar for Beta Folders 4. Beta Folders 33 pts. 9,663
  5. Avatar for Contenders 5. Contenders 22 pts. 9,599
  6. Avatar for Void Crushers 6. Void Crushers 14 pts. 9,556
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 9,445
  8. Avatar for Marvin's bunch 8. Marvin's bunch 5 pts. 9,389
  9. Avatar for HMT heritage 9. HMT heritage 3 pts. 9,285
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 9,115
  1. Avatar for frood66 41. frood66 Lv 1 23 pts. 9,379
  2. Avatar for alcor29 42. alcor29 Lv 1 23 pts. 9,377
  3. Avatar for manu8170 43. manu8170 Lv 1 22 pts. 9,358
  4. Avatar for nicobul 44. nicobul Lv 1 21 pts. 9,347
  5. Avatar for Bletchley Park 45. Bletchley Park Lv 1 20 pts. 9,313
  6. Avatar for WBarme1234 46. WBarme1234 Lv 1 19 pts. 9,310
  7. Avatar for NinjaGreg 47. NinjaGreg Lv 1 18 pts. 9,289
  8. Avatar for O Seki To 48. O Seki To Lv 1 17 pts. 9,285
  9. Avatar for SWR_DMaster 49. SWR_DMaster Lv 1 17 pts. 9,281
  10. Avatar for gmn 50. gmn Lv 1 16 pts. 9,268

Comments