Placeholder image of a protein
Icon representing a puzzle

1402: Unsolved De-novo Freestyle 110

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
July 11, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


EEDELKEYKKQIEKEVSEEETIKIVETILEIIMKTSRSEQILKEIKKIIKKQNSTVHVNIHVGNVHINIHVNDDSVDVQVHVGNVKVTTG

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 9,092
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 8,992
  3. Avatar for :) 13. :) 1 pt. 8,923
  4. Avatar for Russian team 14. Russian team 1 pt. 8,914
  5. Avatar for Deleted group 15. Deleted group pts. 8,002
  6. Avatar for Natural Abilities 16. Natural Abilities 1 pt. 7,512
  1. Avatar for frood66 41. frood66 Lv 1 23 pts. 9,379
  2. Avatar for alcor29 42. alcor29 Lv 1 23 pts. 9,377
  3. Avatar for manu8170 43. manu8170 Lv 1 22 pts. 9,358
  4. Avatar for nicobul 44. nicobul Lv 1 21 pts. 9,347
  5. Avatar for Bletchley Park 45. Bletchley Park Lv 1 20 pts. 9,313
  6. Avatar for WBarme1234 46. WBarme1234 Lv 1 19 pts. 9,310
  7. Avatar for NinjaGreg 47. NinjaGreg Lv 1 18 pts. 9,289
  8. Avatar for O Seki To 48. O Seki To Lv 1 17 pts. 9,285
  9. Avatar for SWR_DMaster 49. SWR_DMaster Lv 1 17 pts. 9,281
  10. Avatar for gmn 50. gmn Lv 1 16 pts. 9,268

Comments