Placeholder image of a protein
Icon representing a puzzle

1402: Unsolved De-novo Freestyle 110

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
July 11, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


EEDELKEYKKQIEKEVSEEETIKIVETILEIIMKTSRSEQILKEIKKIIKKQNSTVHVNIHVGNVHINIHVNDDSVDVQVHVGNVKVTTG

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 9,092
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 8,992
  3. Avatar for :) 13. :) 1 pt. 8,923
  4. Avatar for Russian team 14. Russian team 1 pt. 8,914
  5. Avatar for Deleted group 15. Deleted group pts. 8,002
  6. Avatar for Natural Abilities 16. Natural Abilities 1 pt. 7,512
  1. Avatar for Anton Trikshev 51. Anton Trikshev Lv 1 15 pts. 9,265
  2. Avatar for pvc78 52. pvc78 Lv 1 15 pts. 9,264
  3. Avatar for Glen B 53. Glen B Lv 1 14 pts. 9,261
  4. Avatar for SaraL 54. SaraL Lv 1 13 pts. 9,252
  5. Avatar for katling 55. katling Lv 1 13 pts. 9,199
  6. Avatar for uihcv 56. uihcv Lv 1 12 pts. 9,198
  7. Avatar for tomespen 57. tomespen Lv 1 12 pts. 9,152
  8. Avatar for andrewtmaxwell 58. andrewtmaxwell Lv 1 11 pts. 9,151
  9. Avatar for darioarena 59. darioarena Lv 1 10 pts. 9,115
  10. Avatar for hansvandenhof 60. hansvandenhof Lv 1 10 pts. 9,113

Comments