Placeholder image of a protein
Icon representing a puzzle

1402: Unsolved De-novo Freestyle 110

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
July 11, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


EEDELKEYKKQIEKEVSEEETIKIVETILEIIMKTSRSEQILKEIKKIIKKQNSTVHVNIHVGNVHINIHVNDDSVDVQVHVGNVKVTTG

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,819
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 9,727
  3. Avatar for Gargleblasters 3. Gargleblasters 49 pts. 9,680
  4. Avatar for Beta Folders 4. Beta Folders 33 pts. 9,663
  5. Avatar for Contenders 5. Contenders 22 pts. 9,599
  6. Avatar for Void Crushers 6. Void Crushers 14 pts. 9,556
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 9,445
  8. Avatar for Marvin's bunch 8. Marvin's bunch 5 pts. 9,389
  9. Avatar for HMT heritage 9. HMT heritage 3 pts. 9,285
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 9,115
  1. Avatar for Anton Trikshev 51. Anton Trikshev Lv 1 15 pts. 9,265
  2. Avatar for pvc78 52. pvc78 Lv 1 15 pts. 9,264
  3. Avatar for Glen B 53. Glen B Lv 1 14 pts. 9,261
  4. Avatar for SaraL 54. SaraL Lv 1 13 pts. 9,252
  5. Avatar for katling 55. katling Lv 1 13 pts. 9,199
  6. Avatar for uihcv 56. uihcv Lv 1 12 pts. 9,198
  7. Avatar for tomespen 57. tomespen Lv 1 12 pts. 9,152
  8. Avatar for andrewtmaxwell 58. andrewtmaxwell Lv 1 11 pts. 9,151
  9. Avatar for darioarena 59. darioarena Lv 1 10 pts. 9,115
  10. Avatar for hansvandenhof 60. hansvandenhof Lv 1 10 pts. 9,113

Comments