Placeholder image of a protein
Icon representing a puzzle

1402: Unsolved De-novo Freestyle 110

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
July 11, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


EEDELKEYKKQIEKEVSEEETIKIVETILEIIMKTSRSEQILKEIKKIIKKQNSTVHVNIHVGNVHINIHVNDDSVDVQVHVGNVKVTTG

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,819
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 9,727
  3. Avatar for Gargleblasters 3. Gargleblasters 49 pts. 9,680
  4. Avatar for Beta Folders 4. Beta Folders 33 pts. 9,663
  5. Avatar for Contenders 5. Contenders 22 pts. 9,599
  6. Avatar for Void Crushers 6. Void Crushers 14 pts. 9,556
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 9,445
  8. Avatar for Marvin's bunch 8. Marvin's bunch 5 pts. 9,389
  9. Avatar for HMT heritage 9. HMT heritage 3 pts. 9,285
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 9,115
  1. Avatar for jobo0502 81. jobo0502 Lv 1 3 pts. 8,844
  2. Avatar for pfirth 82. pfirth Lv 1 3 pts. 8,844
  3. Avatar for weitzen 83. weitzen Lv 1 3 pts. 8,814
  4. Avatar for fpc 84. fpc Lv 1 3 pts. 8,813
  5. Avatar for jausmh 85. jausmh Lv 1 3 pts. 8,810
  6. Avatar for FishKAA 86. FishKAA Lv 1 3 pts. 8,762
  7. Avatar for randomlil 87. randomlil Lv 1 2 pts. 8,751
  8. Avatar for toshiue 88. toshiue Lv 1 2 pts. 8,671
  9. Avatar for bcre8tvv 89. bcre8tvv Lv 1 2 pts. 8,656
  10. Avatar for alwen 90. alwen Lv 1 2 pts. 8,655

Comments