Placeholder image of a protein
Icon representing a puzzle

1406: Revisiting Puzzle 134: Rice

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
July 20, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 9,997
  2. Avatar for Go Science 2. Go Science 78 pts. 9,993
  3. Avatar for Beta Folders 3. Beta Folders 60 pts. 9,964
  4. Avatar for Gargleblasters 4. Gargleblasters 45 pts. 9,947
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 33 pts. 9,936
  6. Avatar for Marvin's bunch 6. Marvin's bunch 24 pts. 9,936
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 17 pts. 9,804
  8. Avatar for Void Crushers 8. Void Crushers 12 pts. 9,788
  9. Avatar for Kotocycle 9. Kotocycle 8 pts. 9,694
  10. Avatar for HMT heritage 10. HMT heritage 6 pts. 9,596
  1. Avatar for crpainter 11. crpainter Lv 1 75 pts. 9,904
  2. Avatar for eusair 12. eusair Lv 1 73 pts. 9,897
  3. Avatar for retiredmichael 13. retiredmichael Lv 1 70 pts. 9,895
  4. Avatar for Bruno Kestemont 14. Bruno Kestemont Lv 1 68 pts. 9,893
  5. Avatar for bertro 15. bertro Lv 1 66 pts. 9,875
  6. Avatar for gmn 16. gmn Lv 1 64 pts. 9,866
  7. Avatar for dcrwheeler 17. dcrwheeler Lv 1 62 pts. 9,858
  8. Avatar for fiendish_ghoul 18. fiendish_ghoul Lv 1 60 pts. 9,850
  9. Avatar for Galaxie 19. Galaxie Lv 1 58 pts. 9,837
  10. Avatar for randomlil 20. randomlil Lv 1 56 pts. 9,836

Comments