Placeholder image of a protein
Icon representing a puzzle

1406: Revisiting Puzzle 134: Rice

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
July 20, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 9,997
  2. Avatar for Go Science 2. Go Science 78 pts. 9,993
  3. Avatar for Beta Folders 3. Beta Folders 60 pts. 9,964
  4. Avatar for Gargleblasters 4. Gargleblasters 45 pts. 9,947
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 33 pts. 9,936
  6. Avatar for Marvin's bunch 6. Marvin's bunch 24 pts. 9,936
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 17 pts. 9,804
  8. Avatar for Void Crushers 8. Void Crushers 12 pts. 9,788
  9. Avatar for Kotocycle 9. Kotocycle 8 pts. 9,694
  10. Avatar for HMT heritage 10. HMT heritage 6 pts. 9,596
  1. Avatar for Iron pet 121. Iron pet Lv 1 1 pt. 8,271
  2. Avatar for Alistair69 122. Alistair69 Lv 1 1 pt. 8,220
  3. Avatar for AlexBiohazardous 123. AlexBiohazardous Lv 1 1 pt. 8,192
  4. Avatar for Kiwegapa 124. Kiwegapa Lv 1 1 pt. 8,191
  5. Avatar for rinze 125. rinze Lv 1 1 pt. 8,180
  6. Avatar for Arne Heessels 126. Arne Heessels Lv 1 1 pt. 8,079
  7. Avatar for neonrainbowtime 127. neonrainbowtime Lv 1 1 pt. 8,077
  8. Avatar for Palenta 128. Palenta Lv 1 1 pt. 7,999
  9. Avatar for pandapharmd 129. pandapharmd Lv 1 1 pt. 7,986
  10. Avatar for aheller92 130. aheller92 Lv 1 1 pt. 7,979

Comments