Placeholder image of a protein
Icon representing a puzzle

1406: Revisiting Puzzle 134: Rice

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
July 20, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 9,997
  2. Avatar for Go Science 2. Go Science 78 pts. 9,993
  3. Avatar for Beta Folders 3. Beta Folders 60 pts. 9,964
  4. Avatar for Gargleblasters 4. Gargleblasters 45 pts. 9,947
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 33 pts. 9,936
  6. Avatar for Marvin's bunch 6. Marvin's bunch 24 pts. 9,936
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 17 pts. 9,804
  8. Avatar for Void Crushers 8. Void Crushers 12 pts. 9,788
  9. Avatar for Kotocycle 9. Kotocycle 8 pts. 9,694
  10. Avatar for HMT heritage 10. HMT heritage 6 pts. 9,596
  1. Avatar for Tehnologik1 61. Tehnologik1 Lv 1 12 pts. 9,541
  2. Avatar for stomjoh 62. stomjoh Lv 1 12 pts. 9,489
  3. Avatar for Enzyme 63. Enzyme Lv 1 11 pts. 9,483
  4. Avatar for deLaCeiba 64. deLaCeiba Lv 1 11 pts. 9,465
  5. Avatar for YeshuaLives 65. YeshuaLives Lv 1 10 pts. 9,461
  6. Avatar for toshiue 66. toshiue Lv 1 10 pts. 9,457
  7. Avatar for Deleted player 67. Deleted player 10 pts. 9,452
  8. Avatar for alwen 68. alwen Lv 1 9 pts. 9,442
  9. Avatar for Deleted player 69. Deleted player pts. 9,405
  10. Avatar for ViJay7019 70. ViJay7019 Lv 1 8 pts. 9,399

Comments