Placeholder image of a protein
Icon representing a puzzle

1418: Revisiting Puzzle 137: Rosetta Decoy

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
August 17, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a throwback puzzle to the early days of Foldit. This protein helps to regulate the human immune response, and the starting structure is a Rosetta model. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


YEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSE

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 10,034
  2. Avatar for Contenders 2. Contenders 70 pts. 10,016
  3. Avatar for Marvin's bunch 3. Marvin's bunch 47 pts. 9,968
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 9,897
  5. Avatar for Beta Folders 5. Beta Folders 19 pts. 9,897
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 11 pts. 9,893
  7. Avatar for Go Science 7. Go Science 7 pts. 9,838
  8. Avatar for Void Crushers 8. Void Crushers 4 pts. 9,819
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 2 pts. 9,720
  10. Avatar for Kotocycle 10. Kotocycle 1 pt. 9,519
  1. Avatar for cnhrcolemam 121. cnhrcolemam Lv 1 1 pt. 9,146
  2. Avatar for lamoille 122. lamoille Lv 1 1 pt. 9,136
  3. Avatar for aspadistra 123. aspadistra Lv 1 1 pt. 9,124
  4. Avatar for dbuske 124. dbuske Lv 1 1 pt. 9,112
  5. Avatar for trentis1 125. trentis1 Lv 1 1 pt. 9,106
  6. Avatar for momadoc 126. momadoc Lv 1 1 pt. 9,101
  7. Avatar for mirjamvandelft 127. mirjamvandelft Lv 1 1 pt. 9,099
  8. Avatar for SaraL 128. SaraL Lv 1 1 pt. 9,092
  9. Avatar for Tac1 129. Tac1 Lv 1 1 pt. 9,067
  10. Avatar for lzhchild 130. lzhchild Lv 1 1 pt. 9,040

Comments