Placeholder image of a protein
Icon representing a puzzle

1418: Revisiting Puzzle 137: Rosetta Decoy

Closed since over 8 years ago

Intermediate Overall Prediction

Summary


Created
August 17, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a throwback puzzle to the early days of Foldit. This protein helps to regulate the human immune response, and the starting structure is a Rosetta model. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


YEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSE

Top groups


  1. Avatar for Gargleblasters 100 pts. 10,034
  2. Avatar for Contenders 2. Contenders 70 pts. 10,016
  3. Avatar for Marvin's bunch 3. Marvin's bunch 47 pts. 9,968
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 9,897
  5. Avatar for Beta Folders 5. Beta Folders 19 pts. 9,897
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 11 pts. 9,893
  7. Avatar for Go Science 7. Go Science 7 pts. 9,838
  8. Avatar for Void Crushers 8. Void Crushers 4 pts. 9,819
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 2 pts. 9,720
  10. Avatar for Kotocycle 10. Kotocycle 1 pt. 9,519

  1. Avatar for Imeturoran 101. Imeturoran Lv 1 1 pt. 9,393
  2. Avatar for Mike Cassidy 102. Mike Cassidy Lv 1 1 pt. 9,358
  3. Avatar for xabxs 103. xabxs Lv 1 1 pt. 9,354
  4. Avatar for Arne Heessels 104. Arne Heessels Lv 1 1 pt. 9,343
  5. Avatar for senor pit 105. senor pit Lv 1 1 pt. 9,329
  6. Avatar for rabamino12358 106. rabamino12358 Lv 1 1 pt. 9,319
  7. Avatar for spritz1992 107. spritz1992 Lv 1 1 pt. 9,319
  8. Avatar for tomespen 108. tomespen Lv 1 1 pt. 9,293
  9. Avatar for drumpeter18yrs9yrs 109. drumpeter18yrs9yrs Lv 1 1 pt. 9,288
  10. Avatar for rinze 110. rinze Lv 1 1 pt. 9,274

Comments