Placeholder image of a protein
Icon representing a puzzle

1418: Revisiting Puzzle 137: Rosetta Decoy

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
August 17, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a throwback puzzle to the early days of Foldit. This protein helps to regulate the human immune response, and the starting structure is a Rosetta model. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


YEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSE

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 10,034
  2. Avatar for Contenders 2. Contenders 70 pts. 10,016
  3. Avatar for Marvin's bunch 3. Marvin's bunch 47 pts. 9,968
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 9,897
  5. Avatar for Beta Folders 5. Beta Folders 19 pts. 9,897
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 11 pts. 9,893
  7. Avatar for Go Science 7. Go Science 7 pts. 9,838
  8. Avatar for Void Crushers 8. Void Crushers 4 pts. 9,819
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 2 pts. 9,720
  10. Avatar for Kotocycle 10. Kotocycle 1 pt. 9,519
  1. Avatar for froggs554 91. froggs554 Lv 1 1 pt. 9,495
  2. Avatar for andrewxc 92. andrewxc Lv 1 1 pt. 9,487
  3. Avatar for harvardman 93. harvardman Lv 1 1 pt. 9,476
  4. Avatar for mitarcher 94. mitarcher Lv 1 1 pt. 9,465
  5. Avatar for roman madala 95. roman madala Lv 1 1 pt. 9,463
  6. Avatar for martinf 96. martinf Lv 1 1 pt. 9,425
  7. Avatar for lupussapien 97. lupussapien Lv 1 1 pt. 9,412
  8. Avatar for benrh 98. benrh Lv 1 1 pt. 9,408
  9. Avatar for fryguy 99. fryguy Lv 1 1 pt. 9,401
  10. Avatar for placid.lion 100. placid.lion Lv 1 1 pt. 9,396

Comments