Placeholder image of a protein
Icon representing a puzzle

1418: Revisiting Puzzle 137: Rosetta Decoy

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
August 17, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a throwback puzzle to the early days of Foldit. This protein helps to regulate the human immune response, and the starting structure is a Rosetta model. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


YEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSE

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 10,034
  2. Avatar for Contenders 2. Contenders 70 pts. 10,016
  3. Avatar for Marvin's bunch 3. Marvin's bunch 47 pts. 9,968
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 9,897
  5. Avatar for Beta Folders 5. Beta Folders 19 pts. 9,897
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 11 pts. 9,893
  7. Avatar for Go Science 7. Go Science 7 pts. 9,838
  8. Avatar for Void Crushers 8. Void Crushers 4 pts. 9,819
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 2 pts. 9,720
  10. Avatar for Kotocycle 10. Kotocycle 1 pt. 9,519
  1. Avatar for AlienHivDestroyer 111. AlienHivDestroyer Lv 1 1 pt. 9,249
  2. Avatar for Bletchley Park 112. Bletchley Park Lv 1 1 pt. 9,248
  3. Avatar for jdormaar 113. jdormaar Lv 1 1 pt. 9,245
  4. Avatar for merlel 114. merlel Lv 1 1 pt. 9,207
  5. Avatar for DScott 115. DScott Lv 1 1 pt. 9,204
  6. Avatar for ChurroTheGecko 116. ChurroTheGecko Lv 1 1 pt. 9,198
  7. Avatar for Iron pet 117. Iron pet Lv 1 1 pt. 9,186
  8. Avatar for Alistair69 118. Alistair69 Lv 1 1 pt. 9,167
  9. Avatar for pfirth 119. pfirth Lv 1 1 pt. 9,164
  10. Avatar for fujioyama 120. fujioyama Lv 1 1 pt. 9,152

Comments