Foldit

1418: Revisiting Puzzle 137: Rosetta Decoy

Closed since over 8 years ago

Summary

Created: August 17, 2017
Expires: August 24, 2017 at 18:00 UTC
Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This is a throwback puzzle to the early days of Foldit. This protein helps to regulate the human immune response, and the starting structure is a Rosetta model. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:

YEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSE