Placeholder image of a protein
Icon representing a puzzle

1418: Revisiting Puzzle 137: Rosetta Decoy

Closed since almost 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 17, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a throwback puzzle to the early days of Foldit. This protein helps to regulate the human immune response, and the starting structure is a Rosetta model. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


YEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSE

Top groups


  1. Avatar for Gargleblasters 100 pts. 10,034
  2. Avatar for Contenders 2. Contenders 70 pts. 10,016
  3. Avatar for Marvin's bunch 3. Marvin's bunch 47 pts. 9,968
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 9,897
  5. Avatar for Beta Folders 5. Beta Folders 19 pts. 9,897
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 11 pts. 9,893
  7. Avatar for Go Science 7. Go Science 7 pts. 9,838
  8. Avatar for Void Crushers 8. Void Crushers 4 pts. 9,819
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 2 pts. 9,720
  10. Avatar for Kotocycle 10. Kotocycle 1 pt. 9,519

  1. Avatar for WBarme1234 61. WBarme1234 Lv 1 8 pts. 9,661
  2. Avatar for Superphosphate 62. Superphosphate Lv 1 8 pts. 9,654
  3. Avatar for cobaltteal 63. cobaltteal Lv 1 7 pts. 9,653
  4. Avatar for frostschutz 64. frostschutz Lv 1 7 pts. 9,652
  5. Avatar for manu8170 65. manu8170 Lv 1 7 pts. 9,644
  6. Avatar for stomjoh 66. stomjoh Lv 1 6 pts. 9,642
  7. Avatar for tarimo 67. tarimo Lv 1 6 pts. 9,641
  8. Avatar for Deleted player 68. Deleted player pts. 9,632
  9. Avatar for Glen B 69. Glen B Lv 1 5 pts. 9,628
  10. Avatar for Merf 70. Merf Lv 1 5 pts. 9,618

Comments