Placeholder image of a protein
Icon representing a puzzle

1429: Revisiting Puzzle 140: Rosetta Decoy 4

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
September 12, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains four cysteine residues, but in this state only two of them are expected to oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYL

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,992
  2. Avatar for Gargleblasters 2. Gargleblasters 73 pts. 9,971
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 9,941
  4. Avatar for Void Crushers 4. Void Crushers 36 pts. 9,938
  5. Avatar for Go Science 5. Go Science 24 pts. 9,926
  6. Avatar for Contenders 6. Contenders 16 pts. 9,923
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 10 pts. 9,923
  8. Avatar for HMT heritage 8. HMT heritage 6 pts. 9,893
  9. Avatar for Marvin's bunch 9. Marvin's bunch 4 pts. 9,880
  10. Avatar for Natural Abilities 10. Natural Abilities 2 pts. 9,714
  1. Avatar for machinelves 91. machinelves Lv 1 2 pts. 9,468
  2. Avatar for Deleted player 92. Deleted player pts. 9,464
  3. Avatar for Shortbread 93. Shortbread Lv 1 2 pts. 9,461
  4. Avatar for LOGOLOZ 94. LOGOLOZ Lv 1 2 pts. 9,459
  5. Avatar for tamanrasset 95. tamanrasset Lv 1 2 pts. 9,458
  6. Avatar for roman madala 96. roman madala Lv 1 2 pts. 9,455
  7. Avatar for dizzywings 97. dizzywings Lv 1 2 pts. 9,446
  8. Avatar for rabamino12358 98. rabamino12358 Lv 1 2 pts. 9,436
  9. Avatar for pandapharmd 99. pandapharmd Lv 1 2 pts. 9,423
  10. Avatar for SaraL 100. SaraL Lv 1 2 pts. 9,421

Comments