Placeholder image of a protein
Icon representing a puzzle

1429: Revisiting Puzzle 140: Rosetta Decoy 4

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
September 12, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains four cysteine residues, but in this state only two of them are expected to oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYL

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,992
  2. Avatar for Gargleblasters 2. Gargleblasters 73 pts. 9,971
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 9,941
  4. Avatar for Void Crushers 4. Void Crushers 36 pts. 9,938
  5. Avatar for Go Science 5. Go Science 24 pts. 9,926
  6. Avatar for Contenders 6. Contenders 16 pts. 9,923
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 10 pts. 9,923
  8. Avatar for HMT heritage 8. HMT heritage 6 pts. 9,893
  9. Avatar for Marvin's bunch 9. Marvin's bunch 4 pts. 9,880
  10. Avatar for Natural Abilities 10. Natural Abilities 2 pts. 9,714
  1. Avatar for CaptainZoey 131. CaptainZoey Lv 1 1 pt. 9,121
  2. Avatar for luayahmed9000 132. luayahmed9000 Lv 1 1 pt. 9,121
  3. Avatar for leannerikicheever 133. leannerikicheever Lv 1 1 pt. 9,101
  4. Avatar for miltont 134. miltont Lv 1 1 pt. 9,100
  5. Avatar for xplocast1 135. xplocast1 Lv 1 1 pt. 9,066
  6. Avatar for NotJim99 136. NotJim99 Lv 1 1 pt. 9,046
  7. Avatar for bhodg1 137. bhodg1 Lv 1 1 pt. 9,042
  8. Avatar for Kokosko 138. Kokosko Lv 1 1 pt. 9,037
  9. Avatar for doctaven 139. doctaven Lv 1 1 pt. 9,036
  10. Avatar for kimsejin5 140. kimsejin5 Lv 1 1 pt. 9,036

Comments