Placeholder image of a protein
Icon representing a puzzle

1444: Unsolved De-novo Freestyle 119

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
October 30, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TRELYVEIRGGDKEEIKKLIEEIKRESERLEKEQGGEIRVEVRDHNGNVLIRVEIRGGRDEEIKKMWEKLEKRIKETVKKLGGEVNIQEK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,148
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 78 pts. 10,013
  3. Avatar for Marvin's bunch 3. Marvin's bunch 60 pts. 10,011
  4. Avatar for Beta Folders 4. Beta Folders 45 pts. 9,982
  5. Avatar for Gargleblasters 5. Gargleblasters 33 pts. 9,879
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 24 pts. 9,841
  7. Avatar for Deleted group 7. Deleted group pts. 9,668
  8. Avatar for Void Crushers 8. Void Crushers 12 pts. 9,652
  9. Avatar for Contenders 9. Contenders 8 pts. 9,644
  10. Avatar for Deleted group 10. Deleted group pts. 9,416
  1. Avatar for Vinara 21. Vinara Lv 1 53 pts. 9,676
  2. Avatar for Timo van der Laan 22. Timo van der Laan Lv 1 51 pts. 9,652
  3. Avatar for Mike Cassidy 23. Mike Cassidy Lv 1 50 pts. 9,649
  4. Avatar for Anfinsen_slept_here 24. Anfinsen_slept_here Lv 1 48 pts. 9,641
  5. Avatar for Deleted player 25. Deleted player pts. 9,635
  6. Avatar for mimi 26. mimi Lv 1 45 pts. 9,628
  7. Avatar for drjr 27. drjr Lv 1 43 pts. 9,600
  8. Avatar for nicobul 28. nicobul Lv 1 42 pts. 9,590
  9. Avatar for pvc78 29. pvc78 Lv 1 40 pts. 9,577
  10. Avatar for stomjoh 30. stomjoh Lv 1 39 pts. 9,556

Comments

Susume Lv 1

I really want to mutate that serine in the helix to something else, as in my current model it is a buried polar!