Placeholder image of a protein
Icon representing a puzzle

1456: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
December 03, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups

  1. Avatar for Russian team 11. Russian team 4 pts. 9,619
  2. Avatar for Richard Dawkins Foundation 12. Richard Dawkins Foundation 2 pts. 9,400
  3. Avatar for freefolder 13. freefolder 2 pts. 9,372
  4. Avatar for xkcd 14. xkcd 1 pt. 9,302
  5. Avatar for Alpha Rays 15. Alpha Rays 1 pt. 9,146
  6. Avatar for Eὕρηκα! Heureka! 16. Eὕρηκα! Heureka! 1 pt. 9,144
  7. Avatar for Italiani Al Lavoro 17. Italiani Al Lavoro 1 pt. 9,122
  8. Avatar for Crunching Family 18. Crunching Family 1 pt. 9,111
  9. Avatar for SETI.Germany 19. SETI.Germany 1 pt. 9,104
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 9,021
  1. Avatar for Threeoak 21. Threeoak Lv 1 52 pts. 9,974
  2. Avatar for smilingone 22. smilingone Lv 1 50 pts. 9,960
  3. Avatar for Skippysk8s 23. Skippysk8s Lv 1 48 pts. 9,958
  4. Avatar for christioanchauvin 24. christioanchauvin Lv 1 47 pts. 9,950
  5. Avatar for pvc78 25. pvc78 Lv 1 45 pts. 9,932
  6. Avatar for fiendish_ghoul 26. fiendish_ghoul Lv 1 43 pts. 9,929
  7. Avatar for Blipperman 27. Blipperman Lv 1 42 pts. 9,926
  8. Avatar for Merf 28. Merf Lv 1 40 pts. 9,921
  9. Avatar for Museka 29. Museka Lv 1 39 pts. 9,917
  10. Avatar for stomjoh 30. stomjoh Lv 1 37 pts. 9,909

Comments