Placeholder image of a protein
Icon representing a puzzle

1456: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since over 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
December 03, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups


  1. Avatar for Beta Folders 100 pts. 10,179
  2. Avatar for Go Science 2. Go Science 78 pts. 10,120
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 60 pts. 10,098
  4. Avatar for Gargleblasters 4. Gargleblasters 45 pts. 10,094
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 33 pts. 10,056
  6. Avatar for Contenders 6. Contenders 24 pts. 10,003
  7. Avatar for Marvin's bunch 7. Marvin's bunch 17 pts. 9,999
  8. Avatar for HMT heritage 8. HMT heritage 12 pts. 9,998
  9. Avatar for Void Crushers 9. Void Crushers 8 pts. 9,981
  10. Avatar for GENE 433 10. GENE 433 6 pts. 9,901

  1. Avatar for Threeoak 21. Threeoak Lv 1 52 pts. 9,974
  2. Avatar for smilingone 22. smilingone Lv 1 50 pts. 9,960
  3. Avatar for Skippysk8s 23. Skippysk8s Lv 1 48 pts. 9,958
  4. Avatar for christioanchauvin 24. christioanchauvin Lv 1 47 pts. 9,950
  5. Avatar for pvc78 25. pvc78 Lv 1 45 pts. 9,932
  6. Avatar for fiendish_ghoul 26. fiendish_ghoul Lv 1 43 pts. 9,929
  7. Avatar for Blipperman 27. Blipperman Lv 1 42 pts. 9,926
  8. Avatar for Merf 28. Merf Lv 1 40 pts. 9,921
  9. Avatar for Museka 29. Museka Lv 1 39 pts. 9,917
  10. Avatar for stomjoh 30. stomjoh Lv 1 37 pts. 9,909

Comments