Placeholder image of a protein
Icon representing a puzzle

1456: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
December 03, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups

  1. Avatar for Russian team 11. Russian team 4 pts. 9,619
  2. Avatar for Richard Dawkins Foundation 12. Richard Dawkins Foundation 2 pts. 9,400
  3. Avatar for freefolder 13. freefolder 2 pts. 9,372
  4. Avatar for xkcd 14. xkcd 1 pt. 9,302
  5. Avatar for Alpha Rays 15. Alpha Rays 1 pt. 9,146
  6. Avatar for Eὕρηκα! Heureka! 16. Eὕρηκα! Heureka! 1 pt. 9,144
  7. Avatar for Italiani Al Lavoro 17. Italiani Al Lavoro 1 pt. 9,122
  8. Avatar for Crunching Family 18. Crunching Family 1 pt. 9,111
  9. Avatar for SETI.Germany 19. SETI.Germany 1 pt. 9,104
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 9,021
  1. Avatar for Glen B 31. Glen B Lv 1 36 pts. 9,902
  2. Avatar for Cagdason 32. Cagdason Lv 1 35 pts. 9,901
  3. Avatar for alcor29 33. alcor29 Lv 1 33 pts. 9,901
  4. Avatar for alwen 34. alwen Lv 1 32 pts. 9,895
  5. Avatar for diamonddays 35. diamonddays Lv 1 31 pts. 9,892
  6. Avatar for georg137 36. georg137 Lv 1 30 pts. 9,892
  7. Avatar for YeshuaLives 37. YeshuaLives Lv 1 28 pts. 9,885
  8. Avatar for jobo0502 38. jobo0502 Lv 1 27 pts. 9,881
  9. Avatar for manu8170 39. manu8170 Lv 1 26 pts. 9,857
  10. Avatar for TastyMunchies 40. TastyMunchies Lv 1 25 pts. 9,841

Comments