Placeholder image of a protein
Icon representing a puzzle

1456: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since over 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
December 03, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups


  1. Avatar for Beta Folders 100 pts. 10,179
  2. Avatar for Go Science 2. Go Science 78 pts. 10,120
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 60 pts. 10,098
  4. Avatar for Gargleblasters 4. Gargleblasters 45 pts. 10,094
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 33 pts. 10,056
  6. Avatar for Contenders 6. Contenders 24 pts. 10,003
  7. Avatar for Marvin's bunch 7. Marvin's bunch 17 pts. 9,999
  8. Avatar for HMT heritage 8. HMT heritage 12 pts. 9,998
  9. Avatar for Void Crushers 9. Void Crushers 8 pts. 9,981
  10. Avatar for GENE 433 10. GENE 433 6 pts. 9,901

  1. Avatar for Glen B 31. Glen B Lv 1 36 pts. 9,902
  2. Avatar for Cagdason 32. Cagdason Lv 1 35 pts. 9,901
  3. Avatar for alcor29 33. alcor29 Lv 1 33 pts. 9,901
  4. Avatar for alwen 34. alwen Lv 1 32 pts. 9,895
  5. Avatar for diamonddays 35. diamonddays Lv 1 31 pts. 9,892
  6. Avatar for georg137 36. georg137 Lv 1 30 pts. 9,892
  7. Avatar for YeshuaLives 37. YeshuaLives Lv 1 28 pts. 9,885
  8. Avatar for jobo0502 38. jobo0502 Lv 1 27 pts. 9,881
  9. Avatar for manu8170 39. manu8170 Lv 1 26 pts. 9,857
  10. Avatar for TastyMunchies 40. TastyMunchies Lv 1 25 pts. 9,841

Comments