Placeholder image of a protein
Icon representing a puzzle

1456: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
December 03, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups

  1. Avatar for Russian team 11. Russian team 4 pts. 9,619
  2. Avatar for Richard Dawkins Foundation 12. Richard Dawkins Foundation 2 pts. 9,400
  3. Avatar for freefolder 13. freefolder 2 pts. 9,372
  4. Avatar for xkcd 14. xkcd 1 pt. 9,302
  5. Avatar for Alpha Rays 15. Alpha Rays 1 pt. 9,146
  6. Avatar for Eὕρηκα! Heureka! 16. Eὕρηκα! Heureka! 1 pt. 9,144
  7. Avatar for Italiani Al Lavoro 17. Italiani Al Lavoro 1 pt. 9,122
  8. Avatar for Crunching Family 18. Crunching Family 1 pt. 9,111
  9. Avatar for SETI.Germany 19. SETI.Germany 1 pt. 9,104
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 9,021
  1. Avatar for tomespen 41. tomespen Lv 1 24 pts. 9,836
  2. Avatar for bcre8tvv 42. bcre8tvv Lv 1 23 pts. 9,828
  3. Avatar for Maerlyn138 43. Maerlyn138 Lv 1 22 pts. 9,826
  4. Avatar for yoyoparis 44. yoyoparis Lv 1 21 pts. 9,824
  5. Avatar for dettingen 45. dettingen Lv 1 21 pts. 9,822
  6. Avatar for Deleted player 46. Deleted player pts. 9,819
  7. Avatar for Anfinsen_slept_here 47. Anfinsen_slept_here Lv 1 19 pts. 9,815
  8. Avatar for weitzen 48. weitzen Lv 1 18 pts. 9,812
  9. Avatar for toshiue 49. toshiue Lv 1 17 pts. 9,807
  10. Avatar for Vinara 50. Vinara Lv 1 17 pts. 9,805

Comments