1456: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since over 8 years ago

Summary

• Created: December 03, 2017
• Expires: December 10, 2017 at 23:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups

• 1. Beta Folders 100 pts. 10,179
• 2. Go Science 78 pts. 10,120
• 3. Anthropic Dreams 60 pts. 10,098
• 4. Gargleblasters 45 pts. 10,094
• 5. L'Alliance Francophone 33 pts. 10,056
• 6. Contenders 24 pts. 10,003
• 7. Marvin's bunch 17 pts. 9,999
• 8. HMT heritage 12 pts. 9,998
• 9. Void Crushers 8 pts. 9,981
• 10. GENE 433 6 pts. 9,901

Top soloists

• 41. tomespen 24 pts. 9,836
• 42. bcre8tvv 23 pts. 9,828
• 43. Maerlyn138 22 pts. 9,826
• 44. yoyoparis 21 pts. 9,824
• 45. dettingen 21 pts. 9,822
• 46. Deleted player pts. 9,819
• 47. Anfinsen_slept_here 19 pts. 9,815
• 48. weitzen 18 pts. 9,812
• 49. toshiue 17 pts. 9,807
• 50. Vinara 17 pts. 9,805