Placeholder image of a protein
Icon representing a puzzle

1456: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since over 8 years ago

Intermediate Overall Prediction

Summary


Created
December 03, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups


  1. Avatar for Russian team 11. Russian team 4 pts. 9,619
  2. Avatar for freefolder 13. freefolder 2 pts. 9,372
  3. Avatar for xkcd 14. xkcd 1 pt. 9,302
  4. Avatar for Alpha Rays 15. Alpha Rays 1 pt. 9,146
  5. Avatar for Eὕρηκα! Heureka! 16. Eὕρηκα! Heureka! 1 pt. 9,144
  6. Avatar for Italiani Al Lavoro 17. Italiani Al Lavoro 1 pt. 9,122
  7. Avatar for Crunching Family 18. Crunching Family 1 pt. 9,111
  8. Avatar for SETI.Germany 19. SETI.Germany 1 pt. 9,104
  9. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 9,021

  1. Avatar for Bletchley Park 51. Bletchley Park Lv 1 16 pts. 9,802
  2. Avatar for guineapig 52. guineapig Lv 1 15 pts. 9,801
  3. Avatar for caglar 53. caglar Lv 1 15 pts. 9,800
  4. Avatar for fpc 54. fpc Lv 1 14 pts. 9,791
  5. Avatar for eusair 55. eusair Lv 1 13 pts. 9,787
  6. Avatar for jausmh 56. jausmh Lv 1 13 pts. 9,779
  7. Avatar for isaksson 57. isaksson Lv 1 12 pts. 9,767
  8. Avatar for hansvandenhof 58. hansvandenhof Lv 1 12 pts. 9,755
  9. Avatar for Idiotboy 59. Idiotboy Lv 1 11 pts. 9,750
  10. Avatar for Deleted player 60. Deleted player 11 pts. 9,739

Comments