Placeholder image of a protein
Icon representing a puzzle

1456: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
December 03, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,179
  2. Avatar for Go Science 2. Go Science 78 pts. 10,120
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 60 pts. 10,098
  4. Avatar for Gargleblasters 4. Gargleblasters 45 pts. 10,094
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 33 pts. 10,056
  6. Avatar for Contenders 6. Contenders 24 pts. 10,003
  7. Avatar for Marvin's bunch 7. Marvin's bunch 17 pts. 9,999
  8. Avatar for HMT heritage 8. HMT heritage 12 pts. 9,998
  9. Avatar for Void Crushers 9. Void Crushers 8 pts. 9,981
  10. Avatar for GENE 433 10. GENE 433 6 pts. 9,901
  1. Avatar for Bletchley Park 51. Bletchley Park Lv 1 16 pts. 9,802
  2. Avatar for guineapig 52. guineapig Lv 1 15 pts. 9,801
  3. Avatar for caglar 53. caglar Lv 1 15 pts. 9,800
  4. Avatar for fpc 54. fpc Lv 1 14 pts. 9,791
  5. Avatar for eusair 55. eusair Lv 1 13 pts. 9,787
  6. Avatar for jausmh 56. jausmh Lv 1 13 pts. 9,779
  7. Avatar for isaksson 57. isaksson Lv 1 12 pts. 9,767
  8. Avatar for hansvandenhof 58. hansvandenhof Lv 1 12 pts. 9,755
  9. Avatar for Idiotboy 59. Idiotboy Lv 1 11 pts. 9,750
  10. Avatar for Deleted player 60. Deleted player 11 pts. 9,739

Comments