Placeholder image of a protein
Icon representing a puzzle

1459: Revisiting Puzzle 142: Rosetta Decoy 6

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
December 12, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was evolved in vitro to bind testosterone; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYWVAQWARVDTGVWAYNPADNSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISF

Top groups

  1. Avatar for Minions of TWIS 11. Minions of TWIS 3 pts. 9,539
  2. Avatar for SETI.Germany 12. SETI.Germany 2 pts. 9,504
  3. Avatar for Villanova ChE 13. Villanova ChE 1 pt. 9,445
  4. Avatar for Richard Dawkins Foundation 14. Richard Dawkins Foundation 1 pt. 9,351
  5. Avatar for freefolder 15. freefolder 1 pt. 9,338
  6. Avatar for NE224 F2017 16. NE224 F2017 1 pt. 9,283
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 9,227
  8. Avatar for Team South Africa 18. Team South Africa 1 pt. 9,156
  9. Avatar for Family Style Folding 19. Family Style Folding 1 pt. 9,132
  10. Avatar for Rechenkraft.net 20. Rechenkraft.net 1 pt. 9,067
  1. Avatar for ozanertekin 111. ozanertekin Lv 1 2 pts. 9,436
  2. Avatar for pielie 112. pielie Lv 1 1 pt. 9,436
  3. Avatar for Auntecedent 113. Auntecedent Lv 1 1 pt. 9,428
  4. Avatar for pfirth 114. pfirth Lv 1 1 pt. 9,423
  5. Avatar for dbuske 115. dbuske Lv 1 1 pt. 9,417
  6. Avatar for Ellis Shih 116. Ellis Shih Lv 1 1 pt. 9,407
  7. Avatar for rabamino12358 117. rabamino12358 Lv 1 1 pt. 9,399
  8. Avatar for Kevonni 118. Kevonni Lv 1 1 pt. 9,388
  9. Avatar for mitarcher 119. mitarcher Lv 1 1 pt. 9,383
  10. Avatar for gstelle 120. gstelle Lv 1 1 pt. 9,381

Comments