Placeholder image of a protein
Icon representing a puzzle

1459: Revisiting Puzzle 142: Rosetta Decoy 6

Closed since over 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
December 12, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was evolved in vitro to bind testosterone; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYWVAQWARVDTGVWAYNPADNSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISF

Top groups


  1. Avatar for Minions of TWIS 11. Minions of TWIS 3 pts. 9,539
  2. Avatar for SETI.Germany 12. SETI.Germany 2 pts. 9,504
  3. Avatar for Villanova ChE 13. Villanova ChE 1 pt. 9,445
  4. Avatar for freefolder 15. freefolder 1 pt. 9,338
  5. Avatar for NE224 F2017 16. NE224 F2017 1 pt. 9,283
  6. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 9,227
  7. Avatar for Team South Africa 18. Team South Africa 1 pt. 9,156
  8. Avatar for Family Style Folding 19. Family Style Folding 1 pt. 9,132
  9. Avatar for Rechenkraft.net 20. Rechenkraft.net 1 pt. 9,067

  1. Avatar for momadoc 131. momadoc Lv 1 1 pt. 9,311
  2. Avatar for Master of Games 132. Master of Games Lv 1 1 pt. 9,309
  3. Avatar for muhammedakd 133. muhammedakd Lv 1 1 pt. 9,296
  4. Avatar for rdtoyona 134. rdtoyona Lv 1 1 pt. 9,283
  5. Avatar for pruneau_44 135. pruneau_44 Lv 1 1 pt. 9,282
  6. Avatar for smais 136. smais Lv 1 1 pt. 9,269
  7. Avatar for elcinelif 137. elcinelif Lv 1 1 pt. 9,262
  8. Avatar for lconor 138. lconor Lv 1 1 pt. 9,246
  9. Avatar for aspadistra 139. aspadistra Lv 1 1 pt. 9,227
  10. Avatar for baiyuncanggou 140. baiyuncanggou Lv 1 1 pt. 9,219

Comments