Placeholder image of a protein
Icon representing a puzzle

1459: Revisiting Puzzle 142: Rosetta Decoy 6

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
December 12, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was evolved in vitro to bind testosterone; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYWVAQWARVDTGVWAYNPADNSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISF

Top groups

  1. Avatar for Minions of TWIS 11. Minions of TWIS 3 pts. 9,539
  2. Avatar for SETI.Germany 12. SETI.Germany 2 pts. 9,504
  3. Avatar for Villanova ChE 13. Villanova ChE 1 pt. 9,445
  4. Avatar for Richard Dawkins Foundation 14. Richard Dawkins Foundation 1 pt. 9,351
  5. Avatar for freefolder 15. freefolder 1 pt. 9,338
  6. Avatar for NE224 F2017 16. NE224 F2017 1 pt. 9,283
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 9,227
  8. Avatar for Team South Africa 18. Team South Africa 1 pt. 9,156
  9. Avatar for Family Style Folding 19. Family Style Folding 1 pt. 9,132
  10. Avatar for Rechenkraft.net 20. Rechenkraft.net 1 pt. 9,067
  1. Avatar for Tehnologik1 21. Tehnologik1 Lv 1 57 pts. 10,084
  2. Avatar for Blipperman 22. Blipperman Lv 1 55 pts. 10,077
  3. Avatar for smilingone 23. smilingone Lv 1 53 pts. 10,075
  4. Avatar for NinjaGreg 24. NinjaGreg Lv 1 52 pts. 10,072
  5. Avatar for johnmitch 25. johnmitch Lv 1 50 pts. 10,069
  6. Avatar for fiendish_ghoul 26. fiendish_ghoul Lv 1 48 pts. 10,067
  7. Avatar for alcor29 27. alcor29 Lv 1 47 pts. 10,053
  8. Avatar for Timo van der Laan 28. Timo van der Laan Lv 1 46 pts. 10,041
  9. Avatar for SKSbell 29. SKSbell Lv 1 44 pts. 10,034
  10. Avatar for Flagg65a 30. Flagg65a Lv 1 43 pts. 10,030

Comments