Placeholder image of a protein
Icon representing a puzzle

1459: Revisiting Puzzle 142: Rosetta Decoy 6

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
December 12, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was evolved in vitro to bind testosterone; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYWVAQWARVDTGVWAYNPADNSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISF

Top groups

  1. Avatar for Minions of TWIS 11. Minions of TWIS 3 pts. 9,539
  2. Avatar for SETI.Germany 12. SETI.Germany 2 pts. 9,504
  3. Avatar for Villanova ChE 13. Villanova ChE 1 pt. 9,445
  4. Avatar for Richard Dawkins Foundation 14. Richard Dawkins Foundation 1 pt. 9,351
  5. Avatar for freefolder 15. freefolder 1 pt. 9,338
  6. Avatar for NE224 F2017 16. NE224 F2017 1 pt. 9,283
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 9,227
  8. Avatar for Team South Africa 18. Team South Africa 1 pt. 9,156
  9. Avatar for Family Style Folding 19. Family Style Folding 1 pt. 9,132
  10. Avatar for Rechenkraft.net 20. Rechenkraft.net 1 pt. 9,067
  1. Avatar for stomjoh 41. stomjoh Lv 1 30 pts. 9,994
  2. Avatar for WBarme1234 42. WBarme1234 Lv 1 29 pts. 9,987
  3. Avatar for caglar 43. caglar Lv 1 28 pts. 9,981
  4. Avatar for TastyMunchies 44. TastyMunchies Lv 1 27 pts. 9,973
  5. Avatar for diamonddays 45. diamonddays Lv 1 26 pts. 9,971
  6. Avatar for Mike Cassidy 46. Mike Cassidy Lv 1 25 pts. 9,968
  7. Avatar for manu8170 47. manu8170 Lv 1 24 pts. 9,967
  8. Avatar for Anfinsen_slept_here 48. Anfinsen_slept_here Lv 1 23 pts. 9,963
  9. Avatar for Vinara 49. Vinara Lv 1 22 pts. 9,956
  10. Avatar for drjr 50. drjr Lv 1 22 pts. 9,949

Comments