Placeholder image of a protein
Icon representing a puzzle

1468: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
January 09, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups

  1. Avatar for GENE 433 11. GENE 433 2 pts. 9,622
  2. Avatar for Russian team 12. Russian team 1 pt. 9,496
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 9,227
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 9,136
  5. Avatar for freefolder 15. freefolder 1 pt. 9,096
  6. Avatar for Trinity Biology 16. Trinity Biology 1 pt. 9,096
  7. Avatar for Deleted group 17. Deleted group pts. 9,066
  8. Avatar for Deleted group 18. Deleted group pts. 8,348
  1. Avatar for s-qxie 131. s-qxie Lv 1 1 pt. 9,110
  2. Avatar for Altercomp 132. Altercomp Lv 1 1 pt. 9,096
  3. Avatar for alyssa_d 133. alyssa_d Lv 1 1 pt. 9,096
  4. Avatar for gulsahsimsir 134. gulsahsimsir Lv 1 1 pt. 9,086
  5. Avatar for chiachia 135. chiachia Lv 1 1 pt. 9,066
  6. Avatar for bps_cacchione_2017 136. bps_cacchione_2017 Lv 1 1 pt. 9,057
  7. Avatar for jacalbr 137. jacalbr Lv 1 1 pt. 9,055
  8. Avatar for vercingetorix1982 138. vercingetorix1982 Lv 1 1 pt. 9,048
  9. Avatar for DipsyDoodle2016 139. DipsyDoodle2016 Lv 1 1 pt. 9,043
  10. Avatar for gstelle 140. gstelle Lv 1 1 pt. 9,039

Comments