Placeholder image of a protein
Icon representing a puzzle

1468: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since about 8 years ago

Intermediate Overall Prediction

Summary


Created
January 09, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups


  1. Avatar for Beta Folders 100 pts. 9,795
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 9,790
  3. Avatar for Gargleblasters 3. Gargleblasters 54 pts. 9,790
  4. Avatar for Go Science 4. Go Science 38 pts. 9,774
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 9,772
  6. Avatar for Contenders 6. Contenders 18 pts. 9,768
  7. Avatar for Void Crushers 7. Void Crushers 12 pts. 9,743
  8. Avatar for Marvin's bunch 8. Marvin's bunch 8 pts. 9,735
  9. Avatar for HMT heritage 9. HMT heritage 5 pts. 9,696
  10. Avatar for Deleted group 10. Deleted group pts. 9,689

  1. Avatar for s-qxie 131. s-qxie Lv 1 1 pt. 9,110
  2. Avatar for Altercomp 132. Altercomp Lv 1 1 pt. 9,096
  3. Avatar for alyssa_d 133. alyssa_d Lv 1 1 pt. 9,096
  4. Avatar for gulsahsimsir 134. gulsahsimsir Lv 1 1 pt. 9,086
  5. Avatar for chiachia 135. chiachia Lv 1 1 pt. 9,066
  6. Avatar for bps_cacchione_2017 136. bps_cacchione_2017 Lv 1 1 pt. 9,057
  7. Avatar for jacalbr 137. jacalbr Lv 1 1 pt. 9,055
  8. Avatar for vercingetorix1982 138. vercingetorix1982 Lv 1 1 pt. 9,048
  9. Avatar for DipsyDoodle2016 139. DipsyDoodle2016 Lv 1 1 pt. 9,043
  10. Avatar for gstelle 140. gstelle Lv 1 1 pt. 9,039

Comments