Placeholder image of a protein
Icon representing a puzzle

1468: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since about 8 years ago

Intermediate Overall Prediction

Summary


Created
January 09, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups


  1. Avatar for GENE 433 11. GENE 433 2 pts. 9,622
  2. Avatar for Russian team 12. Russian team 1 pt. 9,496
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 9,227
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 9,136
  5. Avatar for freefolder 15. freefolder 1 pt. 9,096
  6. Avatar for Trinity Biology 16. Trinity Biology 1 pt. 9,096
  7. Avatar for Deleted group 17. Deleted group pts. 9,066
  8. Avatar for Deleted group 18. Deleted group pts. 8,348

  1. Avatar for decu 151. decu Lv 1 1 pt. 8,297
  2. Avatar for bkoep 152. bkoep Lv 1 1 pt. 8,286
  3. Avatar for Hollinas 153. Hollinas Lv 1 1 pt. 8,286
  4. Avatar for sheerbliss 154. sheerbliss Lv 1 1 pt. 8,286
  5. Avatar for StarDen 155. StarDen Lv 1 1 pt. 8,286
  6. Avatar for hein84mailru 156. hein84mailru Lv 1 1 pt. 8,286
  7. Avatar for Susume 157. Susume Lv 1 1 pt. 8,286
  8. Avatar for emtonsti 158. emtonsti Lv 1 1 pt. 8,286
  9. Avatar for artodoxy 159. artodoxy Lv 1 1 pt. 8,286
  10. Avatar for jeff101 160. jeff101 Lv 1 1 pt. 8,286

Comments