Placeholder image of a protein
Icon representing a puzzle

1468: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
January 09, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,795
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 9,790
  3. Avatar for Gargleblasters 3. Gargleblasters 54 pts. 9,790
  4. Avatar for Go Science 4. Go Science 38 pts. 9,774
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 9,772
  6. Avatar for Contenders 6. Contenders 18 pts. 9,768
  7. Avatar for Void Crushers 7. Void Crushers 12 pts. 9,743
  8. Avatar for Marvin's bunch 8. Marvin's bunch 8 pts. 9,735
  9. Avatar for HMT heritage 9. HMT heritage 5 pts. 9,696
  10. Avatar for Deleted group 10. Deleted group pts. 9,689
  1. Avatar for decu 151. decu Lv 1 1 pt. 8,297
  2. Avatar for bkoep 152. bkoep Lv 1 1 pt. 8,286
  3. Avatar for Hollinas 153. Hollinas Lv 1 1 pt. 8,286
  4. Avatar for sheerbliss 154. sheerbliss Lv 1 1 pt. 8,286
  5. Avatar for StarDen 155. StarDen Lv 1 1 pt. 8,286
  6. Avatar for hein84mailru 156. hein84mailru Lv 1 1 pt. 8,286
  7. Avatar for Susume 157. Susume Lv 1 1 pt. 8,286
  8. Avatar for emtonsti 158. emtonsti Lv 1 1 pt. 8,286
  9. Avatar for artodoxy 159. artodoxy Lv 1 1 pt. 8,286
  10. Avatar for jeff101 160. jeff101 Lv 1 1 pt. 8,286

Comments