Placeholder image of a protein
Icon representing a puzzle

1468: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
January 09, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups

  1. Avatar for GENE 433 11. GENE 433 2 pts. 9,622
  2. Avatar for Russian team 12. Russian team 1 pt. 9,496
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 9,227
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 9,136
  5. Avatar for freefolder 15. freefolder 1 pt. 9,096
  6. Avatar for Trinity Biology 16. Trinity Biology 1 pt. 9,096
  7. Avatar for Deleted group 17. Deleted group pts. 9,066
  8. Avatar for Deleted group 18. Deleted group pts. 8,348
  1. Avatar for histon 31. histon Lv 1 37 pts. 9,696
  2. Avatar for MicElephant 32. MicElephant Lv 1 35 pts. 9,695
  3. Avatar for Sissue 33. Sissue Lv 1 34 pts. 9,689
  4. Avatar for Museka 34. Museka Lv 1 33 pts. 9,684
  5. Avatar for Threeoak 35. Threeoak Lv 1 32 pts. 9,680
  6. Avatar for eromana 36. eromana Lv 1 30 pts. 9,676
  7. Avatar for crpainter 37. crpainter Lv 1 29 pts. 9,671
  8. Avatar for weitzen 38. weitzen Lv 1 28 pts. 9,669
  9. Avatar for jausmh 39. jausmh Lv 1 27 pts. 9,668
  10. Avatar for WBarme1234 40. WBarme1234 Lv 1 26 pts. 9,665

Comments