1468: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since about 8 years ago

Summary

• Created: January 09, 2018
• Expires: January 17, 2018 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups

• 1. Beta Folders 100 pts. 9,795
• 2. Anthropic Dreams 74 pts. 9,790
• 3. Gargleblasters 54 pts. 9,790
• 4. Go Science 38 pts. 9,774
• 5. L'Alliance Francophone 27 pts. 9,772
• 6. Contenders 18 pts. 9,768
• 7. Void Crushers 12 pts. 9,743
• 8. Marvin's bunch 8 pts. 9,735
• 9. HMT heritage 5 pts. 9,696
• 10. Deleted group pts. 9,689

Top soloists

• 31. histon 37 pts. 9,696
• 32. MicElephant 35 pts. 9,695
• 33. Sissue 34 pts. 9,689
• 34. Museka 33 pts. 9,684
• 35. Threeoak 32 pts. 9,680
• 36. eromana 30 pts. 9,676
• 37. crpainter 29 pts. 9,671
• 38. weitzen 28 pts. 9,669
• 39. jausmh 27 pts. 9,668
• 40. WBarme1234 26 pts. 9,665