Placeholder image of a protein
Icon representing a puzzle

1468: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
January 09, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups

  1. Avatar for GENE 433 11. GENE 433 2 pts. 9,622
  2. Avatar for Russian team 12. Russian team 1 pt. 9,496
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 9,227
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 9,136
  5. Avatar for freefolder 15. freefolder 1 pt. 9,096
  6. Avatar for Trinity Biology 16. Trinity Biology 1 pt. 9,096
  7. Avatar for Deleted group 17. Deleted group pts. 9,066
  8. Avatar for Deleted group 18. Deleted group pts. 8,348
  1. Avatar for dizzywings 41. dizzywings Lv 1 25 pts. 9,662
  2. Avatar for Maerlyn138 42. Maerlyn138 Lv 1 24 pts. 9,662
  3. Avatar for sharondipity 43. sharondipity Lv 1 23 pts. 9,662
  4. Avatar for guineapig 44. guineapig Lv 1 22 pts. 9,659
  5. Avatar for andrewxc 45. andrewxc Lv 1 21 pts. 9,655
  6. Avatar for YeshuaLives 46. YeshuaLives Lv 1 20 pts. 9,648
  7. Avatar for tarimo 47. tarimo Lv 1 20 pts. 9,648
  8. Avatar for tokens 48. tokens Lv 1 19 pts. 9,645
  9. Avatar for Keresto 49. Keresto Lv 1 18 pts. 9,645
  10. Avatar for Amphimixus 50. Amphimixus Lv 1 17 pts. 9,644

Comments