Placeholder image of a protein
Icon representing a puzzle

1468: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
January 09, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,795
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 9,790
  3. Avatar for Gargleblasters 3. Gargleblasters 54 pts. 9,790
  4. Avatar for Go Science 4. Go Science 38 pts. 9,774
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 9,772
  6. Avatar for Contenders 6. Contenders 18 pts. 9,768
  7. Avatar for Void Crushers 7. Void Crushers 12 pts. 9,743
  8. Avatar for Marvin's bunch 8. Marvin's bunch 8 pts. 9,735
  9. Avatar for HMT heritage 9. HMT heritage 5 pts. 9,696
  10. Avatar for Deleted group 10. Deleted group pts. 9,689
  1. Avatar for dizzywings 41. dizzywings Lv 1 25 pts. 9,662
  2. Avatar for Maerlyn138 42. Maerlyn138 Lv 1 24 pts. 9,662
  3. Avatar for sharondipity 43. sharondipity Lv 1 23 pts. 9,662
  4. Avatar for guineapig 44. guineapig Lv 1 22 pts. 9,659
  5. Avatar for andrewxc 45. andrewxc Lv 1 21 pts. 9,655
  6. Avatar for YeshuaLives 46. YeshuaLives Lv 1 20 pts. 9,648
  7. Avatar for tarimo 47. tarimo Lv 1 20 pts. 9,648
  8. Avatar for tokens 48. tokens Lv 1 19 pts. 9,645
  9. Avatar for Keresto 49. Keresto Lv 1 18 pts. 9,645
  10. Avatar for Amphimixus 50. Amphimixus Lv 1 17 pts. 9,644

Comments